DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-N and ENPP3

DIOPT Version :9

Sequence 1:NP_610549.1 Gene:PIG-N / 36049 FlyBaseID:FBgn0033479 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_005012.2 Gene:ENPP3 / 5169 HGNCID:3358 Length:875 Species:Homo sapiens


Alignment Length:406 Identity:76/406 - (18%)
Similarity:128/406 - (31%) Gaps:149/406 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PPANRLVLIVTDGFRADSFFEENCRYVPNLRKIFLREGVVGV----SRTRVPTETRPGHITLIAG 103
            ||   ::|...|||||:..:..: ..:||:.|:    ...|:    .|...||:|.|.|.|::.|
Human   159 PP---VILFSMDGFRAEYLYTWD-TLMPNINKL----KTCGIHSKYMRAMYPTKTFPNHYTIVTG 215

  Fly   104 LYEDPSAVLRG-----------------------WKSNPIDFDTVF-NRSSQTYAWGANDVLNVF 144
            ||.:...::..                       |...|:....:: ...:.||.|..::|    
Human   216 LYPESHGIIDNNMYDVNLNKNFSLSSKEQNNPAWWHGQPMWLTAMYQGLKAATYFWPGSEV---- 276

  Fly   145 SHVSNGGEINLRF-YNHDLDFSPGYDAYEEDEWVFKRVKLLLQQKREALQRAQNVVFF-LHLLGL 207
              ..||...::.. ||..:.|.             :|:..||  |...|.:|:...|: ::....
Human   277 --AINGSFPSIYMPYNGSVPFE-------------ERISTLL--KWLDLPKAERPRFYTMYFEEP 324

  Fly   208 DTAGHVHKPGAPKFRRTLEKTEKGVYAIYQEFERVFPDKRTAYLLTADHGMTDS----------- 261
            |::||...|.:.:..:.|:..:.....:.:..::.........:|.|||||..:           
Human   325 DSSGHAGGPVSARVIKALQVVDHAFGMLMEGLKQRNLHNCVNIILLADHGMDQTYCNKMEYMTDY 389

  Fly   262 -----------------GAHGSGSPHE---------------------------TDTPFML---- 278
                             .||  ..||:                           .|.|..|    
Human   390 FPRINFFYMYEGPAPRIRAH--NIPHDFFSFNSEEIVRNLSCRKPDQHFKPYLTPDLPKRLHYAK 452

  Fly   279 --------------WGAGASRAVPKPGGRTFMPNNE-----------GPAM----PLHELEQAQL 314
                          |.|..|::....||.....|||           ||:.    .:...|..::
Human   453 NVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFENIEV 517

  Fly   315 TPLMSALLGLAPPMNN 330
            ..||..||.:.|..||
Human   518 YNLMCDLLRIQPAPNN 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-NNP_610549.1 Npp1 10..>265 CDD:224441 52/279 (19%)
GPI_EPT_1 42..335 CDD:293744 76/406 (19%)
PigN 421..834 CDD:282796
ENPP3NP_005012.2 Somatomedin_B 52..91 CDD:279385
Cell attachment site. /evidence=ECO:0000255 78..80
SO 94..137 CDD:197571
Phosphodiesterase 140..510 68/381 (18%)
Enpp 159..525 CDD:293742 71/396 (18%)
Phosphodiest 161..486 CDD:279931 61/352 (17%)
Nuclease 605..875
NUC 627..857 CDD:214683
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.