DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-N and C01B10.9

DIOPT Version :9

Sequence 1:NP_610549.1 Gene:PIG-N / 36049 FlyBaseID:FBgn0033479 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_501023.3 Gene:C01B10.9 / 177430 WormBaseID:WBGene00015283 Length:555 Species:Caenorhabditis elegans


Alignment Length:304 Identity:66/304 - (21%)
Similarity:112/304 - (36%) Gaps:83/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RLVLIVTDGFRADSFFEENCRYVPNLRK-----IFLREGVVGVSRTRVPTETRPGHITLIAGLYE 106
            :|:||..||||.|...|.   ..||:.|     .:...||    :::..|.|.|.|:::..||:|
 Worm    24 KLLLISFDGFRYDLLDEV---LTPNIHKWASMSTWFTSGV----KSQYVTYTAPNHMSIATGLFE 81

  Fly   107 DPSAVLRGWKSNPIDFDT--------------VFNRSSQTYAWGANDVLNVFSHVSNGGEINLRF 157
            :...::..:.   .|.||              |.|.|.::: |..:|.:.:.:........:..|
 Worm    82 EEHGIVGNYF---FDADTKKAFDYFNSTGKEGVVNASQESF-WYNSDPIWLTNERWESSRRSAAF 142

  Fly   158 Y--NHDLDF----------SPGYDAYEEDEWVFKRVKLLLQQKREALQRAQNVVFFLHLLGLDTA 210
            |  |.:..|          .|.....:...|:.....::     :|..|.:..|.||       |
 Worm   143 YWPNGESQFPYIPHKPKIARPWTIVGDLKSWMKDADDVI-----DAFIREKEPVNFL-------A 195

  Fly   211 GHVHKP-----GAPKFRRTLEKTEKGVYAIYQEFERVFPDKRTA----YLLTADHGMTDSGAH-- 264
            .:|.:|     |.....:.:|||.|.:..::..|.:.|.|....    .:||||||..:...|  
 Worm   196 WYVAEPDHTLHGNGFHNKEIEKTLKKLDDLFLYFIKKFDDNNLGADVNIILTADHGHAEIKDHKH 260

  Fly   265 ---------GSG--------SPHETDTPFMLWGAGASRAVPKPG 291
                     |:|        .||..:....:: |..:.||.:.|
 Worm   261 VMCVKDYVSGAGFEMGDHMIYPHSDEIGKQIY-ANLTSAVKEHG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-NNP_610549.1 Npp1 10..>265 CDD:224441 58/268 (22%)
GPI_EPT_1 42..335 CDD:293744 66/304 (22%)
PigN 421..834 CDD:282796
C01B10.9NP_501023.3 Enpp 23..409 CDD:293742 66/304 (22%)
Phosphodiest 25..368 CDD:279931 66/303 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.