DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-N and ENPP6

DIOPT Version :9

Sequence 1:NP_610549.1 Gene:PIG-N / 36049 FlyBaseID:FBgn0033479 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_699174.1 Gene:ENPP6 / 133121 HGNCID:23409 Length:440 Species:Homo sapiens


Alignment Length:256 Identity:56/256 - (21%)
Similarity:100/256 - (39%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LYYGLEPPAN---RLVLIVTDGFRADSFFEENCRYVPNLRKIFLREGVVGVSRTRVPTETRPGHI 98
            |..||..||:   :|::.:.||||:|...:|....:|..::|..|...|.......|:.:.|.:.
Human    12 LALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYY 76

  Fly    99 TLIAGLYEDPSAVLRGWKSNPI---DFDTVFNRSS-QTYAWGANDVL---------NVFSHVSNG 150
            ||:.|.:.:...::..:..:|.   .||...|:.| ....|..::.|         .|:.:...|
Human    77 TLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGSEPLWVTLTKAKRKVYMYYWPG 141

  Fly   151 GEIN---------LRFYN--HDLDF----SPGYDAYEEDEWVFKRVKLLLQQKREALQRAQNVVF 200
            .|:.         |.:.|  .|::|    |...|:::..                   ||.....
Human   142 CEVEILGVRPTYCLEYKNVPTDINFANAVSDALDSFKSG-------------------RADLAAI 187

  Fly   201 FLHLLGLDTAGHVHKPGAPKFRRTLEKTEKGV-YAIYQEFERVFPDKRTAYLLTADHGMTD 260
            :..  .:|..||.:.|.:|:.:..|:..:..: |......||...| |...::.:||||||
Human   188 YHE--RIDVEGHHYGPASPQRKDALKAVDTVLKYMTKWIQERGLQD-RLNVIIFSDHGMTD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-NNP_610549.1 Npp1 10..>265 CDD:224441 56/256 (22%)
GPI_EPT_1 42..335 CDD:293744 53/251 (21%)
PigN 421..834 CDD:282796
ENPP6NP_699174.1 Enpp 24..397 CDD:293742 51/244 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.