DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and sparcl1

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001124077.1 Gene:sparcl1 / 567331 ZFINID:ZDB-GENE-060130-6 Length:606 Species:Danio rerio


Alignment Length:277 Identity:66/277 - (23%)
Similarity:105/277 - (37%) Gaps:83/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TGKSDDQLMKLPACAAKQ-GECDDNEGP---VCGTDGQTYPTRCHLLRAQCG------GHQVSLK 72
            |.|.:|:  ..|.|..:: .||..|...   |||||.:||.:.|||...:||      ||::.|.
Zfish   384 TCKLNDE--NKPLCVCQEPTECPPNVNDFEHVCGTDNKTYDSSCHLFATKCGLEGTKLGHRLHLD 446

  Fly    73 YSGSCN---ACLEA--VKFARRQQERDPGYFVPRCRKDGNFAAMQCYGNNGCWCSDSQGRPIADD 132
            |:|||.   .|:|:  |:|..|.::         ..|:   ..:|.|.::    |.|.|...|  
Zfish   447 YTGSCKFIAPCVESELVQFPLRMRD---------WLKN---VLLQLYEHD----SMSPGFLTA-- 493

  Fly   133 NKQFRRKGKLRCRANRRDRRRLASHQIGYNPDTSASKGSSEAGSTAHRTCSKSDRSQFNTNLMRM 197
                  |.::|.:......|||                  .||........:.....:|..:   
Zfish   494 ------KQRIRVQKIYESERRL------------------HAGDHPVEILQQDFEKNYNMYI--- 531

  Fly   198 FRNEAQSFFRQPSLSDSHILEWQFSKLDTN-GNKLLDRQEIRELKKVLRRNVKPRRCGRTFGKYC 261
                             :.:.|||:::|.: .::.|...|:..|:..|   |....|...|.:.|
Zfish   532 -----------------YPVHWQFAQMDQHPSDRFLTHSELAPLRVPL---VPMEHCTSVFFQMC 576

  Fly   262 DVTKDANLNWLEWSVCF 278
            |..||..:::.||..||
Zfish   577 DADKDKLVSFKEWCSCF 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052 19/47 (40%)
TY 88..139 CDD:238114 8/50 (16%)
SPARC_Ca_bdg 180..274 CDD:287550 16/94 (17%)
SPARC_EC <219..281 CDD:238155 19/61 (31%)
TY 396..463 CDD:238114
sparcl1NP_001124077.1 MDN1 <38..332 CDD:331582
KAZAL_FS 373..454 CDD:320757 27/71 (38%)
EFh_SPARC_EC 457..597 CDD:330171 39/202 (19%)
EF-hand motif 530..562 CDD:320009 7/51 (14%)
EF-hand motif 565..595 CDD:320009 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.