DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and Tmeff2

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_062764.1 Gene:Tmeff2 / 56363 MGIID:1861735 Length:374 Species:Mus musculus


Alignment Length:231 Identity:43/231 - (18%)
Similarity:81/231 - (35%) Gaps:72/231 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TGKSDDQLMKL---PACAAKQGECDDNEGPVCGTDGQTYPTRCHLLRAQC--------------- 64
            |.|.|.:.:::   ..|.. |.:|:.:..||||::|::|...|:|.:|.|               
Mouse    73 TCKFDGECLRIGDTVTCVC-QFKCNSDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCA 136

  Fly    65 -------------GGHQVSLKYSGSCNACLEAVKFARRQQERDPGYFVPRCRKDGNFAAMQCYGN 116
                         |..:.|.|.:.:|:.|                .|...|.:|.......|   
Mouse   137 TDTGSGSGDGVHEGSGETSQKETSTCDIC----------------QFGAECDEDAEDVWCVC--- 182

  Fly   117 NGCWCSDSQGRPI-ADDNKQFRRKGKLRCRANRRDRRRLASHQIGYNPDTSASKGSSEAGSTAHR 180
             ...||.:...|: |.|.|.:....::: .|:.:.:.::....:|...|.:.:...||.|..|  
Mouse   183 -NIDCSQTNFNPLCASDGKSYDNACQIK-EASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYA-- 243

  Fly   181 TCSKSDRSQFNTNLMRMFRNEAQSFFRQPSLSDSHI 216
                  |:.:..|..::          :.|..:.||
Mouse   244 ------RTDYAENANKL----------EESAREHHI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052 14/66 (21%)
TY 88..139 CDD:238114 10/51 (20%)
SPARC_Ca_bdg 180..274 CDD:287550 5/37 (14%)
SPARC_EC <219..281 CDD:238155
TY 396..463 CDD:238114
Tmeff2NP_062764.1 KAZAL_FS 95..135 CDD:238052 11/39 (28%)
KAZAL 181..227 CDD:197624 9/50 (18%)
PHA02887 <236..301 CDD:165214 9/46 (20%)
Required for shedding. /evidence=ECO:0000250 303..320
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.