DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment magu and IGFBP6

DIOPT Version :9

Sequence 1:	NP_610548.2	Gene:	magu / 36048	FlyBaseID:	FBgn0262169	Length:	613	Species:	Drosophila melanogaster
Sequence 2:	NP_002169.1	Gene:	IGFBP6 / 3489	HGNCID:	5475	Length:	240	Species:	Homo sapiens

Alignment Length:	144	Identity:	34/144 - (23%)
Similarity:	49/144 - (34%)	Gaps:	34/144 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   329 NPHSYSEDASGSEEHEDNYEDSATGYGGEEDDS-------QGADLPSSRTHIPSLYMLNSKPETA 386
            ||......|..:...:.|..|.....|.....|       |..::...|.|:.|:..
Human   116 NPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQ-------- 172

  Fly   387 SQDLENDSNCWMDQSVTLEEQGHGGKSVLFVPQCLPDGRYQRIQCYSSTS--TSYCWCVNEDTGK 449
                            .|:.:.:.|...|:||.|...|.|::.||.||..  ...||||:. .||
Human   173 ----------------QLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDR-MGK 220

  Fly   450 SIPGTSVKNKRPQC 463
            |:||:...|....|
Human   221 SLPGSPDGNGSSSC 234

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
magu	NP_610548.2	KAZAL_FS	38..77	CDD:238052
		TY	88..139	CDD:238114
		SPARC_Ca_bdg	180..274	CDD:287550
		SPARC_EC	<219..281	CDD:238155
		TY	396..463	CDD:238114	22/68 (32%)
IGFBP6	NP_002169.1	IB	27..105	CDD:197525
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	109..160		8/43 (19%)
		Thyroglobulin_1	163..234	CDD:306570	25/95 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	217..240		7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000