DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and IGFBP1

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_000587.1 Gene:IGFBP1 / 3484 HGNCID:5469 Length:259 Species:Homo sapiens


Alignment Length:173 Identity:42/173 - (24%)
Similarity:59/173 - (34%) Gaps:45/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 HTNTIGTGV----------------NPHSYSEDASGSEEHEDNYEDSATGYGGEEDDSQGADLPS 368
            |..|.|.|.                :|.|........||..||:...|.   .|||.|...|..|
Human    95 HALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAP---SEEDHSILWDAIS 156

  Fly   369 SRTHIPSLYMLNSKPETASQDLENDSNCWMD----------QSVTLEEQGHGGK-SVLFVPQCLP 422
            :.....:|::.|.|.             |.:          :|:...::..|.: |..::|.|..
Human   157 TYDGSKALHVTNIKK-------------WKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNK 208

  Fly   423 DGRYQRIQCYSST--STSYCWCVNEDTGKSIPGTSVKNKRPQC 463
            :|.|...||.:|.  ....||||....||.|||:......|.|
Human   209 NGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052
TY 88..139 CDD:238114
SPARC_Ca_bdg 180..274 CDD:287550
SPARC_EC <219..281 CDD:238155
TY 396..463 CDD:238114 21/79 (27%)
IGFBP1NP_000587.1 IB 28..105 CDD:197525 4/9 (44%)
Thyroglobulin_1 176..251 CDD:278514 20/74 (27%)
Cell attachment site 246..248 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.