DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and Igfbp2

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_037254.2 Gene:Igfbp2 / 25662 RGDID:2873 Length:304 Species:Rattus norvegicus


Alignment Length:402 Identity:71/402 - (17%)
Similarity:100/402 - (24%) Gaps:198/402 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GSCNACLEAVKFARRQQERDPGYFVPRCRKDGNFAAMQCYGNNGCWCSDSQGRPIADDNKQFRRK 139
            |.|:.|       .||:....|.::|||.:     .::||.|.|      ...|:.         
  Rat    69 GCCSVC-------ARQEGEACGVYIPRCAQ-----TLRCYPNPG------SELPLK--------- 106

  Fly   140 GKLRCRANRRDRRRLASHQIGYNPDTSASKGSSEAGSTAHRTCSKSDRSQFNTNLMRMFRNEAQS 204
             .|...|...::||     :|..|...|.              |:.|.|                
  Rat   107 -ALVTGAGTCEKRR-----VGATPQQVAD--------------SEDDHS---------------- 135

  Fly   205 FFRQPSLSDSHILEWQFSKLDTNGNKLLDRQEIRELKKVLRRNVKPRRCGRTFGKYCDVTKDANL 269
               :..|.::|:                                                 |..:
  Rat   136 ---EGGLVENHV-------------------------------------------------DGTM 148

  Fly   270 NWLEWSVCFTKEFHNRSAVVNLLASSAATAPPHS--THYSIHNTNVNGHHRGHTNTIGTGVNPHS 332
            |.|.                   .|||...||.|  ...::....||..||    .:|.|....|
  Rat   149 NMLG-------------------GSSAGRKPPKSGMKELAVFREKVNEQHR----QMGKGAKHLS 190

  Fly   333 YSED---------ASGSEEHEDNYEDSATGYGGEEDDSQGADLPSSRTHIPSLYMLNSKPETASQ 388
            ..|.         ....:|.:...|..:|           ..||..|..:..||.|:        
  Rat   191 LEEPKKLRPPPARTPCQQELDQVLERIST-----------MRLPDDRGPLEHLYSLH-------- 236

  Fly   389 DLENDSNCWMDQSVTLEEQGHGGKSVLFVPQCLPDGRYQRIQCYSSTS--TSYCWCVNEDTGKSI 451
                                        :|.|...|.|...||..|.:  ...|||||.:|||.|
  Rat   237 ----------------------------IPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKPI 273

  Fly   452 PGTSVKNKRPQC 463
            .|.......|:|
  Rat   274 QGAPTIRGDPEC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052 1/1 (100%)
TY 88..139 CDD:238114 11/50 (22%)
SPARC_Ca_bdg 180..274 CDD:287550 8/93 (9%)
SPARC_EC <219..281 CDD:238155 3/61 (5%)
TY 396..463 CDD:238114 18/68 (26%)
Igfbp2NP_037254.2 IB 38..116 CDD:197525 16/74 (22%)
Thyroglobulin_1 206..285 CDD:278514 27/125 (22%)
Cell attachment site 280..282 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.