DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and Sparc

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_033268.1 Gene:Sparc / 20692 MGIID:98373 Length:302 Species:Mus musculus


Alignment Length:261 Identity:55/261 - (21%)
Similarity:86/261 - (32%) Gaps:82/261 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ACAAKQGECDDNEGPVCGTDGQTYPTRCHLLRAQC------GGHQVSLKYSGSCN---ACL--EA 83
            :|.|..||.:    .||..|.:|:.:.||....:|      .||::.|.|.|.|.   .||  |.
Mouse    99 SCPAPIGEFE----KVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSEL 159

  Fly    84 VKFARRQQERDPGYFVPRCRKDGNFAAMQCYGNNGCWCSDSQGRPIADDNKQFRRKGKLRCRANR 148
            .:|..|.::......|....:|                         :.|.....|.|||.:...
Mouse   160 TEFPLRMRDWLKNVLVTLYERD-------------------------EGNNLLTEKQKLRVKKIH 199

  Fly   149 RDRRRLASHQIGYNPDTSASKGSSEAGSTAHRTCSKSDRSQFNTNLMRMFRNEAQSFFRQPSLSD 213
            .:.:||                  |||.......::.....:|   |.:|.              
Mouse   200 ENEKRL------------------EAGDHPVELLARDFEKNYN---MYIFP-------------- 229

  Fly   214 SHILEWQFSKLDTNG-NKLLDRQEIRELKKVLRRNVKPRRCGRTFGKYCDVTKDANLNWLEWSVC 277
               :.|||.:||.:. :..|...|:..|:..|   :....|...|.:.||:..|..:...||:.|
Mouse   230 ---VHWQFGQLDQHPIDGYLSHTELAPLRAPL---IPMEHCTTRFFETCDLDNDKYIALEEWAGC 288

  Fly   278 F 278
            |
Mouse   289 F 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052 12/44 (27%)
TY 88..139 CDD:238114 4/50 (8%)
SPARC_Ca_bdg 180..274 CDD:287550 17/94 (18%)
SPARC_EC <219..281 CDD:238155 18/61 (30%)
TY 396..463 CDD:238114
SparcNP_033268.1 FSL_SPARC 70..151 CDD:238649 17/55 (31%)
EFh_SPARC_SPARC 154..293 CDD:320014 38/202 (19%)
EF-hand motif 226..259 CDD:320014 10/52 (19%)
EF-hand motif 261..293 CDD:320014 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.