DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and smoc-1

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_505964.1 Gene:smoc-1 / 179609 WormBaseID:WBGene00011437 Length:260 Species:Caenorhabditis elegans


Alignment Length:253 Identity:70/253 - (27%)
Similarity:116/253 - (45%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 LYMLNSKPETASQDLE----NDSN---------------CWMDQSVTLEEQGHGGKSVLFVPQCL 421
            :|::|..|......||    .|||               |...:...|:.:..|...: ::|.|.
 Worm    14 IYLINGNPIVQKGGLEVLDITDSNDLSVRQRFEEVIRLDCASQRRKALKRKTDGDARI-YIPTCS 77

  Fly   422 PDGR--YQRIQCYSSTSTSYCWCVNEDTGKSIPGTSVKNKRPQCDE----SVA---VRPMKGCTE 477
            |...  |.::|||.  .:.|||||:|.:|:...|:|....:|:|:|    :||   ||....|.|
 Worm    78 PKNSLLYDKVQCYD--VSIYCWCVDELSGEPKLGSSTTRGKPKCEETPTTTVAPKRVRRNNRCKE 140

  Fly   478 PRKTQFLKELKAYLNTSLLPSSTTGSNSS-----MWKTDDERIATLSFVYLDKNKNKSWDRREWK 537
            .::|:||:.|.:.|.:.::.|....:..|     .||          |..|:.|.|...:|.|||
 Worm   141 KKRTRFLRRLVSTLKSEMIMSGINATKVSRDSAIRWK----------FNQLNINHNNVLERSEWK 195

  Fly   538 NFRDLVTSASHLRRCGKKMPRYCDVNGDKKISLAEWLNCL-QATPRESATTAKPAQSN 594
            .|:.::....::|:|.:.:.:.||:|.|:|::..||..|: |...|..|  .:|.|.|
 Worm   196 PFKSVLLEWKNVRQCSRNLFKTCDLNKDRKLTFDEWRKCIVQEINRVPA--KRPDQLN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052
TY 88..139 CDD:238114
SPARC_Ca_bdg 180..274 CDD:287550
SPARC_EC <219..281 CDD:238155
TY 396..463 CDD:238114 20/68 (29%)
smoc-1NP_505964.1 TY 53..119 CDD:238114 20/68 (29%)
SPARC_EC 138..238 CDD:238155 30/109 (28%)
EF-hand_7 174..230 CDD:290234 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165896
Domainoid 1 1.000 52 1.000 Domainoid score I7746
eggNOG 1 0.900 - - E1_KOG4578
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7093
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057719at2759
OrthoFinder 1 1.000 - - FOG0004129
OrthoInspector 1 1.000 - - oto19727
orthoMCL 1 0.900 - - OOG6_109000
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3895
SonicParanoid 1 1.000 - - X2872
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.630

Return to query results.
Submit another query.