DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and Igfbp2

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_032368.2 Gene:Igfbp2 / 16008 MGIID:96437 Length:305 Species:Mus musculus


Alignment Length:404 Identity:69/404 - (17%)
Similarity:102/404 - (25%) Gaps:201/404 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GSCNACLEAVKFARRQQERDPGYFVPRCRKDGNFAAMQCYGNNGCWCSDSQGRPIADDNKQFRRK 139
            |.|:.|       .||:....|.::|||.:     .::||.|.|      ...|:.         
Mouse    69 GCCSVC-------ARQEGEACGVYIPRCAQ-----TLRCYPNPG------SELPLK--------- 106

  Fly   140 GKLRCRANRRDRRRLAS--HQIGYNPDTSASKGSSE-----------AGSTAHRTCSKSDRSQFN 191
             .|...|...::||:.:  .|:..:.|..:..|..|           .||:|.|...||...:  
Mouse   107 -ALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLKSGMKE-- 168

  Fly   192 TNLMRMFRNEAQSFFRQPSLSDSHILEWQFSKLDTNGNKLLDRQEIRELKKVLRRNVKPRRCGRT 256
               :.:||.:.....||......|:                   .:.|.||     ::|      
Mouse   169 ---LAVFREKVNEQHRQMGKGAKHL-------------------SLEEPKK-----LRP------ 200

  Fly   257 FGKYCDVTKDANLNWLEWSVCFTKEFHNRSAVVNLLASSAATAPPHSTHYSIHNTNVNGHHRGHT 321
                                                       ||..|                 
Mouse   201 -------------------------------------------PPART----------------- 205

  Fly   322 NTIGTGVNPHSYSEDASGSEEHEDNYEDSATGYGGEEDDSQGADLPSSRTHIPSLYMLNSKPETA 386
                            ...:|.:...|..:|           ..||..|..:..||.|:      
Mouse   206 ----------------PCQQELDQVLERIST-----------MRLPDDRGPLEHLYSLH------ 237

  Fly   387 SQDLENDSNCWMDQSVTLEEQGHGGKSVLFVPQCLPDGRYQRIQCYSSTS--TSYCWCVNEDTGK 449
                                          :|.|...|||...||..|.:  ...|||||.:|||
Mouse   238 ------------------------------IPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGK 272

  Fly   450 SIPGTSVKNKRPQC 463
            .|.|.......|:|
Mouse   273 PIQGAPTIRGDPEC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052 1/1 (100%)
TY 88..139 CDD:238114 11/50 (22%)
SPARC_Ca_bdg 180..274 CDD:287550 12/93 (13%)
SPARC_EC <219..281 CDD:238155 4/61 (7%)
TY 396..463 CDD:238114 19/68 (28%)
Igfbp2NP_032368.2 IB 38..116 CDD:197525 16/74 (22%)
Thyroglobulin_1 207..286 CDD:278514 28/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.