powered by:
Protein Alignment magu and SPINK13
DIOPT Version :9
Sequence 1: | NP_610548.2 |
Gene: | magu / 36048 |
FlyBaseID: | FBgn0262169 |
Length: | 613 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001035218.1 |
Gene: | SPINK13 / 153218 |
HGNCID: | 27200 |
Length: | 94 |
Species: | Homo sapiens |
Alignment Length: | 54 |
Identity: | 13/54 - (24%) |
Similarity: | 23/54 - (42%) |
Gaps: | 1/54 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 MKLPACAAKQGECDDNEGPVCGTDGQTYPTRCHLLRAQCGGH-QVSLKYSGSCN 78
|.:|.......:|.:...|||.::|.|:...|.....|...| ::..:..|.|:
Human 41 MYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.