powered by:
Protein Alignment magu and AgaP_AGAP009527
DIOPT Version :9
Sequence 1: | NP_610548.2 |
Gene: | magu / 36048 |
FlyBaseID: | FBgn0262169 |
Length: | 613 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_310163.2 |
Gene: | AgaP_AGAP009527 / 1271381 |
VectorBaseID: | AGAP009527 |
Length: | 94 |
Species: | Anopheles gambiae |
Alignment Length: | 77 |
Identity: | 22/77 - (28%) |
Similarity: | 30/77 - (38%) |
Gaps: | 10/77 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VLFVTWLAVFIATGKSDDQLMKLPACAAKQGECDDNEGPVCGTDGQTYPTRCHLLRAQCG---GH 67
||.|..:||.:..|.:...........| |.....|:||:|..||...| :||.:.. |.
Mosquito 9 VLLVALVAVLVLPGSTSAFRRNYNGVCA----CPKIYRPICGSDLITYANSC-ILRCKVDSSYGK 68
Fly 68 QVSLKY--SGSC 77
.|.|:. .|.|
Mosquito 69 SVQLRILRDGEC 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.