powered by:
Protein Alignment magu and Spink9
DIOPT Version :9
Sequence 1: | NP_610548.2 |
Gene: | magu / 36048 |
FlyBaseID: | FBgn0262169 |
Length: | 613 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003749244.2 |
Gene: | Spink9 / 100911241 |
RGDID: | 1596746 |
Length: | 87 |
Species: | Rattus norvegicus |
Alignment Length: | 44 |
Identity: | 16/44 - (36%) |
Similarity: | 21/44 - (47%) |
Gaps: | 6/44 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 CDDNEGPVCGTDGQTYPTRCHL----LRAQCGGHQVSLKYSGSC 77
|.....|||||||:||..||.. :....| ::..|:.|.|
Rat 46 CPKIHKPVCGTDGKTYQNRCEFCQTAMERSVG--KLGFKHEGKC 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.