powered by:
Protein Alignment magu and igfbp6b
DIOPT Version :9
Sequence 1: | NP_610548.2 |
Gene: | magu / 36048 |
FlyBaseID: | FBgn0262169 |
Length: | 613 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001154874.2 |
Gene: | igfbp6b / 100301946 |
ZFINID: | ZDB-GENE-090521-2 |
Length: | 212 |
Species: | Danio rerio |
Alignment Length: | 52 |
Identity: | 17/52 - (32%) |
Similarity: | 29/52 - (55%) |
Gaps: | 3/52 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 415 LFVPQCLPDGRYQRIQCYSS--TSTSYCWCVNEDTGKSIPGTSVKNKRPQCD 464
:::|.|...|.|::.||.|| ....:||||:| .|.::|..:.::....||
Zfish 160 IYIPNCDTRGFYRKKQCRSSKGMQRGHCWCVDE-LGNTVPSRAGEDGILPCD 210
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.