DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment magu and spock2

DIOPT Version :9

Sequence 1:NP_610548.2 Gene:magu / 36048 FlyBaseID:FBgn0262169 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_012821500.1 Gene:spock2 / 100144943 XenbaseID:XB-GENE-1003767 Length:422 Species:Xenopus tropicalis


Alignment Length:442 Identity:77/442 - (17%)
Similarity:119/442 - (26%) Gaps:225/442 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VCGTDGQTYPTRCHLLRAQC-GGHQVSLKYSGSCNACLEAVKFARRQQERDPGYFVPRCRKDGNF 108
            |||:||.||.:.|.|.:..| ...|:::|..|||....|                          
 Frog   143 VCGSDGHTYSSVCKLEQQACLSSKQLTVKCQGSCPCPTE-------------------------- 181

  Fly   109 AAMQCYGNNGCWCSDSQGRPIADDNKQFRRKGKLRCRANRRDRRRLASHQIGYNPDTSASKGSSE 173
                                                                :.|.|:...|.. 
 Frog   182 ----------------------------------------------------HTPTTTTETGKQ- 193

  Fly   174 AGSTAHRTCSKSDRSQFNTNLMRMFR----NEAQSFFRQPSLSDSHILE------------WQFS 222
                 ..||:..|.:.....|...|:    |..|:....|.....::|:            |.||
 Frog   194 -----GETCTGQDLADLGDRLRDWFQLLHENSKQNNTSNPGSKQVNVLDKSLVAGCKDSIGWMFS 253

  Fly   223 KLDTNGNKLLDRQEIRELKKVLRRNV-KPRRCGRTFGKYCDVTKDANLNWLEWSVCFTKEFHNRS 286
            |||:|.:..||:.|:..:      |: |...|.|.|...||..||..::..||..||.:|     
 Frog   254 KLDSNNDLFLDQAELAAI------NLDKYEICIRPFFNSCDTYKDGRVSTAEWCFCFWRE----- 307

  Fly   287 AVVNLLASSAATAPPHSTHYSIHNTNVNGHHRGHTNTIGTGVNPHSYSEDASGSEEHEDNYEDSA 351
                        .||                                                  
 Frog   308 ------------KPP-------------------------------------------------- 310

  Fly   352 TGYGGEEDDSQGADLPSSRTHIPSLYMLNSKPETASQDLENDSNCWMD-QSVTLEEQGHGGKSVL 415
                                                        |.:: :.|.::|... .|..:
 Frog   311 --------------------------------------------CLVELEKVQIQEAAK-RKPGV 330

  Fly   416 FVPQCLPDGRYQRIQCYSSTSTSYCWCVNEDTGKSIPGTSVKNKRPQCDESV 467
            |:|.|..||.|:::||  ..::..||||::. |..:.||.: :..|.||:.|
 Frog   331 FIPSCDEDGYYRKMQC--DQASGECWCVDQH-GSELTGTRI-HGNPDCDDMV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maguNP_610548.2 KAZAL_FS 38..77 CDD:238052 13/32 (41%)
TY 88..139 CDD:238114 0/50 (0%)
SPARC_Ca_bdg 180..274 CDD:287550 28/110 (25%)
SPARC_EC <219..281 CDD:238155 23/62 (37%)
TY 396..463 CDD:238114 20/67 (30%)
spock2XP_012821500.1 KAZAL <143..176 CDD:197624 13/32 (41%)
EFh_SPARC_TICN2 197..308 CDD:320017 32/133 (24%)
EF-hand motif 244..275 CDD:320017 11/36 (31%)
EF-hand motif 276..308 CDD:320017 12/48 (25%)
TY 310..374 CDD:238114 21/162 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.