DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sel and Cnpy1

DIOPT Version :9

Sequence 1:NP_610547.1 Gene:sel / 36046 FlyBaseID:FBgn0263260 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_003749698.1 Gene:Cnpy1 / 685001 RGDID:1583296 Length:134 Species:Rattus norvegicus


Alignment Length:150 Identity:36/150 - (24%)
Similarity:55/150 - (36%) Gaps:49/150 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FRLDAQGNSISKKVRLVKSEMFLTELMEKICEKMDDYL--------------------KATYKSN 99
            |.:.:....:.|.|.|.:||.||.:|::|:|.:|:||.                    ...||..
  Rat     8 FCVSSSIQQLLKMVPLAQSEAFLIDLLDKVCVRMNDYQLEDDPVTKQKYFRRYAPRKGDKIYKEY 72

  Fly   100 GKFTLLKMIINGQMNPDSSLVDFVQDGDLNKSLGHFCNEVLED-NDEIF-VKAFQAEELGNDLDI 162
            .||...                    .|..:.|...|..::|. .|||| :.|.:|..|.:    
  Rat    73 KKFFFY--------------------SDAYRPLKFACEAIIEKYEDEIFELIAQEAHHLAD---- 113

  Fly   163 KICSEQASYC---DESPVQE 179
            .:|||::..|   ..||..|
  Rat   114 MLCSEKSDLCGTPTNSPEPE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
selNP_610547.1 DUF3456 26..166 CDD:288766 29/132 (22%)
Cnpy1XP_003749698.1 DUF3456 <19..117 CDD:403222 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1417418at2759
OrthoFinder 1 1.000 - - FOG0003185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.