DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sel and Cnpy2

DIOPT Version :9

Sequence 1:NP_610547.1 Gene:sel / 36046 FlyBaseID:FBgn0263260 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_030101044.1 Gene:Cnpy2 / 56530 MGIID:1928477 Length:201 Species:Mus musculus


Alignment Length:172 Identity:48/172 - (27%)
Similarity:95/172 - (55%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFGLLALAQGYSFTSREVKCHVCKAVVTELEEAIAKEDPHKMADVSGFRLDAQGNSISKKVRLV 71
            :|.|:| |...::..|:::.|..|:|:|.|||..||:.||.|...:..||::..|:....:|...
Mouse    28 LLLGVL-LGTAWARRSQDLHCGACRALVDELEWEIARVDPKKTIQMGSFRINPDGSQSVVEVPYA 91

  Fly    72 KSEMFLTELMEKICEKMDDYLKATYKSNGKFTLLKMIINGQMNPDSSLVDFVQ---DGDLNKSLG 133
            :||..||||:|::|::|.:|.:....|..:...::::   ..|.:||.:|...   |.|::.:|.
Mouse    92 RSEAHLTELLEEVCDRMKEYGEQIDPSTHRKNYVRVV---SRNGESSELDLQGIRIDSDISGTLK 153

  Fly   134 HFCNEVLEDNDEIFVKAFQAEELGNDLDIKICSEQASYCDES 175
            ..|..::|:.::..::.|..|  .:::..|:||::...||.:
Mouse   154 FACESIVEEYEDELIEFFSRE--ADNVKDKLCSKRTDLCDHA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
selNP_610547.1 DUF3456 26..166 CDD:288766 39/142 (27%)
Cnpy2XP_030101044.1 DUF3456 46..184 CDD:371810 39/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832407
Domainoid 1 1.000 77 1.000 Domainoid score I8855
eggNOG 1 0.900 - - E1_KOG3782
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5157
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48415
OrthoDB 1 1.010 - - D1417418at2759
OrthoFinder 1 1.000 - - FOG0003185
OrthoInspector 1 1.000 - - oto94072
orthoMCL 1 0.900 - - OOG6_105647
Panther 1 1.100 - - LDO PTHR13341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.