DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sel and cnpy2

DIOPT Version :9

Sequence 1:NP_610547.1 Gene:sel / 36046 FlyBaseID:FBgn0263260 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001016251.1 Gene:cnpy2 / 549005 XenbaseID:XB-GENE-943173 Length:184 Species:Xenopus tropicalis


Alignment Length:172 Identity:48/172 - (27%)
Similarity:88/172 - (51%) Gaps:7/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILFGLLALAQGYSFTSR--EVKCHVCKAVVTELEEAIAKEDPHKMADVSGFRLDAQGNSISKKV 68
            |:...|:||. ||:...|  :|.|..|:|:|.|||..|::.||.|......||::..|.....:|
 Frog    10 LLPIALVALV-GYACARRGQDVHCGACRALVDELEWEISQVDPKKTIQKGSFRINPDGTQSVIEV 73

  Fly    69 RLVKSEMFLTELMEKICEKMDDYLKATYKSNGKFTLLKMIINGQMNPDSSLVDFVQDGDLNKSLG 133
            ...:||..|.|::|:|||||.:|.:....|..:...::::.......|:|..:.  |.::..:|.
 Frog    74 PYARSEAHLMEVLEQICEKMTEYGEKIDPSTDRKIYVRVVSRDGKKMDASGTNI--DIEVTSNLK 136

  Fly   134 HFCNEVLEDNDEIFVKAFQAEELGNDLDIKICSEQASYCDES 175
            ..|..::|:.::..::.|..|.  .::..|:||::...||.:
 Frog   137 FTCERIVEEYEDELIEFFSHER--ENVKDKLCSKRTDLCDHA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
selNP_610547.1 DUF3456 26..166 CDD:288766 36/139 (26%)
cnpy2NP_001016251.1 DUF3456 31..167 CDD:403222 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8806
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5074
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1417418at2759
OrthoFinder 1 1.000 - - FOG0003185
OrthoInspector 1 1.000 - - otm48828
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.