DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sel and cnpy1

DIOPT Version :9

Sequence 1:NP_610547.1 Gene:sel / 36046 FlyBaseID:FBgn0263260 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001034586.1 Gene:cnpy1 / 402819 ZFINID:ZDB-GENE-060315-3 Length:187 Species:Danio rerio


Alignment Length:168 Identity:49/168 - (29%)
Similarity:80/168 - (47%) Gaps:32/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CHVCKAVVTELEEAIAKEDPHKMADVSGFRLDAQGNSISKKVRLVKSEMFLTELMEKICEKMDDY 91
            |..|.|:..|:..:|::.||.||..|.||||...|:...|||.|.:||.:||||:|::|:.|.||
Zfish    32 CSACMAIADEINYSISQTDPKKMIHVGGFRLKPDGSLTDKKVPLARSETYLTELLEEVCKSMSDY 96

  Fly    92 L--------KATYK-------SNGKFTLLKMIINGQMNPDSSLVDFVQDG-DLNKSLGHFCNEVL 140
            .        :.:||       ..|.|            ||  ..:|..|| :.:.:|...|..::
Zfish    97 ALYENPDTKEKSYKRFAPRDNDGGNF------------PD--FKNFKFDGPESSSALKFACESIV 147

  Fly   141 EDNDEIFVKAFQAEELGNDLDIKICSEQASYCDESPVQ 178
            |:.::..:..|.::  .:.:...:|||.:.:|..|..|
Zfish   148 EELEDDIISLFASD--SDHVAKTLCSEVSDHCKSSVFQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
selNP_610547.1 DUF3456 26..166 CDD:288766 43/154 (28%)
cnpy1NP_001034586.1 DUF3456 31..171 CDD:288766 43/154 (28%)
Prevents secretion from ER. /evidence=ECO:0000255 184..187 49/168 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575283
Domainoid 1 1.000 75 1.000 Domainoid score I9017
eggNOG 1 0.900 - - E1_KOG3782
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5192
OMA 1 1.010 - - QHG48415
OrthoDB 1 1.010 - - D1417418at2759
OrthoFinder 1 1.000 - - FOG0003185
OrthoInspector 1 1.000 - - otm24244
orthoMCL 1 0.900 - - OOG6_105647
Panther 1 1.100 - - O PTHR13341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.