DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sel and Cnpy1

DIOPT Version :9

Sequence 1:NP_610547.1 Gene:sel / 36046 FlyBaseID:FBgn0263260 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001297440.1 Gene:Cnpy1 / 269637 MGIID:2442451 Length:94 Species:Mus musculus


Alignment Length:47 Identity:15/47 - (31%)
Similarity:23/47 - (48%) Gaps:4/47 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DLNKSLGHFCNEVLED-NDEIFVKAFQAEELGNDLDIKICSEQASYC 172
            |..:.|...|..::|. .||||  ...|:| .|.|...:|:|::..|
Mouse    42 DAFRPLKFACEAIIEKYEDEIF--ELIAQE-ANHLADMLCNEKSDLC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
selNP_610547.1 DUF3456 26..166 CDD:288766 12/39 (31%)
Cnpy1NP_001297440.1 DUF3456 <2..78 CDD:288766 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.