powered by:
Protein Alignment sel and Cnpy1
DIOPT Version :9
Sequence 1: | NP_610547.1 |
Gene: | sel / 36046 |
FlyBaseID: | FBgn0263260 |
Length: | 189 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001297440.1 |
Gene: | Cnpy1 / 269637 |
MGIID: | 2442451 |
Length: | 94 |
Species: | Mus musculus |
Alignment Length: | 47 |
Identity: | 15/47 - (31%) |
Similarity: | 23/47 - (48%) |
Gaps: | 4/47 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 DLNKSLGHFCNEVLED-NDEIFVKAFQAEELGNDLDIKICSEQASYC 172
|..:.|...|..::|. .|||| ...|:| .|.|...:|:|::..|
Mouse 42 DAFRPLKFACEAIIEKYEDEIF--ELIAQE-ANHLADMLCNEKSDLC 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167832408 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003185 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4170 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.960 |
|
Return to query results.
Submit another query.