DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sel and F01F1.15

DIOPT Version :9

Sequence 1:NP_610547.1 Gene:sel / 36046 FlyBaseID:FBgn0263260 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001379735.1 Gene:F01F1.15 / 175824 WormBaseID:WBGene00017169 Length:193 Species:Caenorhabditis elegans


Alignment Length:199 Identity:46/199 - (23%)
Similarity:87/199 - (43%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALAQGYSFTSREVKCHVCKAVVTELEEAIAKEDPHKMADVSGFRLDAQGNSIS-KKVRLVKSE 74
            |::|:...|.:...::|..|..:||..|..||..||.|..:|..||:...|:... |::...:||
 Worm    10 LISLSGIQSASVSSLECGACSLLVTHFELKIAAVDPKKKIEVGSFRVSPTGDQKGLKEIGYARSE 74

  Fly    75 MFLTELMEKICEKMDDYLKATYKSNGKFTLLKMIIN---GQ---MNPDSSLVDFVQDGDLNKSLG 133
            ..|||::|..|:....|              |:::|   |:   ::.|::.:...:...:..:|.
 Worm    75 SHLTEIIEHACDDAKHY--------------KLVVNTITGKSVYVHNDATHLKGDESPKMRYNLQ 125

  Fly   134 HFCNEVLEDN-DEIF----------VKAFQAEELGNDLDIKICSEQASYCDESPVQ----EEYDF 183
            :.||:.::.: ||:.          ||.|...|:|....:.:....|:  .|.|:.    .:.:.
 Worm   126 NACNDFIDSHEDELLGFLKTAHQDPVKQFCQGEMGACTAVDVAPLPAA--PEEPMDLSDIPDDEI 188

  Fly   184 DGKE 187
            |.||
 Worm   189 DRKE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
selNP_610547.1 DUF3456 26..166 CDD:288766 37/157 (24%)
F01F1.15NP_001379735.1 DUF3456 26..156 CDD:403222 35/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159828
Domainoid 1 1.000 47 1.000 Domainoid score I8166
eggNOG 1 0.900 - - E1_KOG3782
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I4127
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48415
OrthoDB 1 1.010 - - D1417418at2759
OrthoFinder 1 1.000 - - FOG0003185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105647
Panther 1 1.100 - - LDO PTHR13341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.