DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oys and MBOAT7

DIOPT Version :9

Sequence 1:NP_001286265.1 Gene:oys / 36045 FlyBaseID:FBgn0033476 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_077274.3 Gene:MBOAT7 / 79143 HGNCID:15505 Length:472 Species:Homo sapiens


Alignment Length:479 Identity:105/479 - (21%)
Similarity:192/479 - (40%) Gaps:90/479 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FLICQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIH-----------IAG 88
            :|:..:.::.:..||:      |....|:...|.::||....|..|...:|           |..
Human     8 YLVVLLISIPIGFLFK------KAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLVTILGTWALIQA 66

  Fly    89 LPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYDYGSYALDITGPL-----MIITQKVT 148
            .|..|:.:            .|....||||....:..|      .|....|.     :::|.|:.
Human    67 QPCSCHAL------------ALAWTFSYLLFFRALSLL------GLPTPTPFTNAVQLLLTLKLV 113

  Fly   149 SLAFSIHDGFVRGDEEL----TKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVE 209
            |||..:.|..:...:|:    :|......:..:||.:|..||.:.:..|:.||...|:.|::::|
Human   114 SLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLE 178

  Fly   210 GYNLLSTPPGNGNLDSSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNN 274
                   .|..|.:.|      |.|     ::|:...:.:...:|:....::|::.::||.|...
Human   179 -------QPFPGAVPS------LRP-----LLRRAWPAPLFGLLFLLSSHLFPLEAVREDAFYAR 225

  Fly   275 TSMVYKYWYAMMATTCIRFKYYHAWLLADAICNNSGLGF--------------------TGYDKD 319
             .:..:.:|.:......|.::|.||:.|:..|..:|.|.                    :..:|.
Human   226 -PLPARLFYMIPVFFAFRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQCPPPSSPEKA 289

  Fly   320 GNSKWD--LISNINVLSFEFSTNMRDAINNWNCGTNRWLRTLVYERVPQQYGTL---LTFALSAV 379
            .:.::|  .|.||:..|.:|...:||.:..||.....||...:|:..|.:...|   .|..|||.
Human   290 ASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTMLLSAY 354

  Fly   380 WHGFYPGYYLTFATGAVVVTAARTGRRLFRHRFQSTQVTRMFYDILTCLITRVVLGYATFPFVLL 444
            |||.:|||||:|.|  :.:..|..||.....|.:.:...:..:|.:...:......|....||||
Human   355 WHGLHPGYYLSFLT--IPLCLAAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLL 417

  Fly   445 EFMGSIKLYLRFYLCLHIISLVTI 468
            ....:::.:...|.|:|.::|..:
Human   418 SLADTLRYWASIYFCIHFLALAAL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oysNP_001286265.1 MBOAT 22..484 CDD:294479 105/479 (22%)
MBOAT7NP_077274.3 MBOAT 2..431 CDD:294479 101/467 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475957at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.