DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oys and por

DIOPT Version :9

Sequence 1:NP_001286265.1 Gene:oys / 36045 FlyBaseID:FBgn0033476 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001259679.1 Gene:por / 32818 FlyBaseID:FBgn0004957 Length:525 Species:Drosophila melanogaster


Alignment Length:394 Identity:85/394 - (21%)
Similarity:152/394 - (38%) Gaps:76/394 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LICQISALFLASLFR-SMLHPSKVSSKLRHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRT 99
            |:|::..|..:...| :.|.|       .|.|..:.||.......|.:.:.:..|.|:.|:::  
  Fly    95 LLCRLLCLLYSQRRRLTSLAP-------LHLFHFACGLIILQITVGYRLLLLLLLAAVGYLLL-- 150

  Fly   100 QDPRIVQR-----AVLLVAMSYLLCVHLMRQLYDYGSYALDITGPLMIITQKVTSLAFSIHDGFV 159
            |..|:.:|     |||.|...:|..:.:.|:..|:.    .:.|..|::..|:.||.|       
  Fly   151 QLLRLGRRGAQVLAVLTVGSQFLYELLIWRRRSDWP----QLRGIQMVVNMKLISLGF------- 204

  Fly   160 RGDEELTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLVFYKDYIEFVEGYNLLSTPPGNGNLD 224
                :||.:.|..|  ::|....|..|::...:...||.|.:..|::.:        .|.|..|.
  Fly   205 ----DLTASGQLQA--RIPGPFAYLGYIYSPATCALGPWVSFGCYMDCL--------VPRNSWLV 255

  Fly   225 SSKREVVLEPSPTKAVIRKVVGSLVCAFIFMKFVKIYPVKDMKEDDFMNNTSMVYKYWYAMMATT 289
            |.:|   |.|:....|:...|.:.|...:              .|.|.:::..:..||.|:    
  Fly   256 SLRR---LLPNVVICVLAVTVSNCVAPAL--------------SDFFGDSSHFLVMYWDAL---- 299

  Fly   290 CIRFKYYHAWLLADAICNNSGLGFTGYDKDGNSKWDLISNINVLSFEFSTNMRDAINNWNCGTNR 354
            .:|..:|...::|.|:...|.....|..|:.:....|||  .....|:..::...:.:||...:.
  Fly   300 SVRSSHYFVGMMAQALLVASDQRLDGATKESDMLGPLIS--QPWRIEWPRSISSLVRSWNIPMHE 362

  Fly   355 WLRTLVYERVPQQYGT---------LLTFALSAVWHGFYPGYYLTFATGAVVVTAARTGRRLFRH 410
            ||:..:|........|         |.|:.:|::.||.....||...:.|.:.    .|..|.|.
  Fly   363 WLKRYIYAPCKPTASTSRGRILVVVLSTYLVSSLLHGMDLRIYLVLISLAFLA----EGESLLRR 423

  Fly   411 RFQS 414
            :..|
  Fly   424 QLAS 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oysNP_001286265.1 MBOAT 22..484 CDD:294479 85/394 (22%)
porNP_001259679.1 MBOAT 161..459 CDD:281107 68/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13906
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.