DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and PFA4

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:439 Identity:107/439 - (24%)
Similarity:159/439 - (36%) Gaps:135/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WIPVLFITAVIAW-SYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGR--- 82
            |:.:...|.:|:: .|.|:...|     .|.:.:...:.| ...|::...||:..|.|:.||   
Yeast     9 WLGIAIPTFLISFIGYGAHYFIL-----SNFLSVPKQITF-EFCLSMIWLSYYLAICTNPGRPLP 67

  Fly    83 ----IPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAH 143
                .||.||                                        .||:||:..||:|:|
Yeast    68 NYKPPPDIWR----------------------------------------NFCKKCQSYKPERSH 92

  Fly   144 HCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALV-----YC-----LYVAFTSLHDFVE 198
            ||..|:.|||.|||||||..|||.|.||.:|:.||.:.:|     :|     :|..:...|....
Yeast    93 HCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGY 157

  Fly   199 FWKVGAYDNNGYSAQGQLNASGMGRFHILFL--FFIAIMFAIS---------LVSLFG------- 245
            |:|..  :....:....||:..:....||||  .|..|:...|         |.|||.       
Yeast   158 FFKKS--ELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQK 220

  Fly   246 -----YHIY---LVLVNRTTLESF---RAPIF--RVGGPDKNGYNLGRYANFCEVFGDDWQYWFL 297
                 :.||   ....|:...|..   :.|.|  .|..|    |:...|.|.....| ....|..
Yeast   221 LIDNTWRIYPESRSFQNKKDAEEHLTKKRPRFDELVNFP----YDFDLYTNALLYLG-PIHLWLW 280

  Fly   298 PVFSSRGDGYSYPTSSDQSRVSTSSPTQRYDAMGDTTTSRL------DGNPTDKLIGASPLDTTN 356
            |.....|||.::|.:.          ..:|:|........|      ||..|:          |.
Yeast   281 PYGVPTGDGNNFPKNG----------ISKYEANSSLEDHILSLPWPPDGGKTN----------TV 325

  Fly   357 HHHNQSPHQVRSTSVLPTQLLQIQPPSTCRDELNERQQKLAN--GQSLD 403
            .:|..|..::|:.|  ..||::.:.|...|   :..::|..|  |:|||
Yeast   326 FNHGSSTIEMRNES--GEQLIRTRLPQNGR---HASREKWYNDWGESLD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 52/165 (32%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 98/409 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1716
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.