DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and ZDHHC16

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006718084.1 Gene:ZDHHC16 / 84287 HGNCID:20714 Length:384 Species:Homo sapiens


Alignment Length:338 Identity:95/338 - (28%)
Similarity:143/338 - (42%) Gaps:91/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFKWIPVLFITAVIAWS------YYAYVVELCIRN-SENRIGMIFMLLFY-HLFLTLFMWSYWRT 75
            |.:|..|:|:..||..:      .|..|:.|.:|. |..|:...|   || |..|.|.::.|::.
Human    75 VIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHF---FYSHWNLILIVFHYYQA 136

  Fly    76 IMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPD 140
            |.|..| .|.|.|                      |:.|            :|..|:||...||.
Human   137 ITTPPG-YPPQGR----------------------NDIA------------TVSICKKCIYPKPA 166

  Fly   141 RAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFW----K 201
            |.||||:|:.|||||||||||:||||..||::||..|..:..:.|:|.::.|...|.|.:    |
Human   167 RTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEK 231

  Fly   202 VGAYDNNGYSAQGQLNASGMGRFH-----------------ILFLFFIAIM-------FAISLVS 242
            :...|.|      :|.|.....:|                 :::|:|:..:       .|::|.:
Human   232 MKQLDKN------KLQAVANQTYHQTPPPTFSFRERMTHKSLVYLWFLCSLRPSFLSSVALALGA 290

  Fly   243 LFGYHIYLVLVNRTTLESF-----RAPIFRVGGPDKNGYNLGRYANFCEVFG-DDWQYWFLPVF- 300
            |..:|..|:....|::|..     |..:...|...:|.||.|...|:....| |..::|...|. 
Human   291 LTVWHAVLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLL 355

  Fly   301 -SS---RGDGYSY 309
             ||   .|:|.|:
Human   356 PSSHLPHGNGMSW 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 50/157 (32%)
ZDHHC16XP_006718084.1 zf-DHHC 155..312 CDD:279823 51/162 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.