DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and AT5G04270

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_196047.3 Gene:AT5G04270 / 830306 AraportID:AT5G04270 Length:271 Species:Arabidopsis thaliana


Alignment Length:317 Identity:92/317 - (29%)
Similarity:139/317 - (43%) Gaps:67/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CMAVFKWIPVLFITAVIAWSYYAYVVELC-----IRNSENRIGMIFMLLFYHLFLTLFMWSYWRT 75
            |...|. ||||.:..|:.:.||..:....     :::|..::.    .|.:.|..:|.::|....
plant     3 CRRFFS-IPVLLVILVMGFVYYVTLFVFIDDWVGLQSSAGKLN----ALLFSLLASLCLFSLSIC 62

  Fly    76 IMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPD 140
            ::...||:|..: .||.|.|....::..:|:|                       |:||...||.
plant    63 VLVDPGRVPASY-APDVEDSGWSNSNVTETRK-----------------------CDKCFAYKPL 103

  Fly   141 RAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLY-------VAFTSLHDFVE 198
            |.|||.||..|||||||||.|:||||.:.|||.|.:.:.||.|..:|       .||        
plant   104 RTHHCRVCRRCVLKMDHHCLWINNCVGYANYKAFFILVFYATVASIYSTVLLVCCAF-------- 160

  Fly   199 FWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESF-- 261
                    .||.|..|.:..    :..|:......|..:|:|.:|..:||||:..|.||:|.:  
plant   161 --------KNGDSYAGNVPL----KTFIVSCGIFMIGLSITLGTLLCWHIYLITHNMTTIEHYDS 213

  Fly   262 -RAP-IFRVGGPD-KNGYNLGRYANFCEVFGDDWQYWFLPVFS-SRGDGYSYPTSSD 314
             ||. :.|..|.. ::.:::|.|.|...|.|.:...|..|.|: :..||.|:..|.|
plant   214 KRASWLARKSGQSYRHQFDVGFYKNLTSVLGPNMIKWLCPTFTRNPEDGISFSASRD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 51/136 (38%)
AT5G04270NP_196047.3 DHHC 90..211 CDD:396215 54/163 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 1 1.000 - - FOG0000300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.