DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and SMO1-2

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_567670.1 Gene:SMO1-2 / 828374 AraportID:AT4G22756 Length:299 Species:Arabidopsis thaliana


Alignment Length:163 Identity:30/163 - (18%)
Similarity:50/163 - (30%) Gaps:64/163 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 HCPWVNNCVNFYNYKYFVLFLGYALVYCLY--VAFTSLHDF----------VEFW------KVGA 204
            ||.|.....:..:::| ...:|||..|..:  |....:..|          :.||      ::.|
plant   151 HCKWGYEKFHHIHHEY-TAPIGYAAPYAHWAEVLLLGIPTFLGPAIAPGHMITFWLWIALRQIEA 214

  Fly   205 YD-NNGYSAQGQLNA----SGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAP 264
            .: ::||.....|..    .|...:|                   .||.|               
plant   215 IETHSGYDFPWSLTKYIPFYGGAEYH-------------------DYHHY--------------- 245

  Fly   265 IFRVGGPDKNGYNLGRYANFCE-VFGDDWQYWF 296
               |||..::  |......:|: ::|.|..|.|
plant   246 ---VGGQSQS--NFASVFTYCDYIYGTDKGYRF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 21/123 (17%)
SMO1-2NP_567670.1 FA_hydroxylase 132..267 CDD:397991 26/155 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H57105
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.