DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and AT3G09320

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_566348.1 Gene:AT3G09320 / 820088 AraportID:AT3G09320 Length:286 Species:Arabidopsis thaliana


Alignment Length:316 Identity:97/316 - (30%)
Similarity:147/316 - (46%) Gaps:53/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IPVLFITAVIAWSYYAYVVELCIR--NSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPD 85
            :||..:..||.:.|:|.|.....|  :..:..|:.....|..|.| :.:::|...:....||:|.
plant    10 LPVTVVMLVIGFIYFASVFTFIDRWFSLTSSPGIANAAAFTALAL-MCIYNYSIAVFRDPGRVPL 73

  Fly    86 QWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTN-RTMNGSVRFCEKCKIIKPDRAHHCSVCS 149
            .: :||.|        .|::            ||.. :...|.:|:|:||...||.|||||.||.
plant    74 NY-MPDVE--------DPES------------PVHEIKRKGGDLRYCQKCSHFKPPRAHHCRVCK 117

  Fly   150 CCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLY-----VAFTSLHDFVEFWKVGAYDNNG 209
            .|||:|||||.|:||||...|||.|.:|:.||:..|:|     |...::....|..::|:|....
plant   118 RCVLRMDHHCIWINNCVGHTNYKVFFVFVVYAVTACVYSLVLLVGSLTVEPQDEEEEMGSYLRTI 182

  Fly   210 YSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTL---ESFRAP-IFRVGG 270
            |                :...|:.|..:|:|..|.|:||||:|.|:||:   |..||. :...||
plant   183 Y----------------VISAFLLIPLSIALGVLLGWHIYLILQNKTTIEYHEGVRAMWLAEKGG 231

  Fly   271 P-DKNGYNLGRYANFCEVFGDDWQYWFLPVFSSRGDGYSYPTSSDQSRVSTSSPTQ 325
            . .|:.|::|.|.|...:.|.:...|..|.....|.|..:.|:.|.  :..||.|:
plant   232 QVYKHPYDIGAYENLTLILGPNILSWLCPTSRHIGSGVRFRTAFDS--IPDSSETK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 54/137 (39%)
AT3G09320NP_566348.1 DHHC 94..217 CDD:396215 55/138 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 109 1.000 Domainoid score I2118
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 1 1.000 - - FOG0000300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.