DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:421 Identity:107/421 - (25%)
Similarity:157/421 - (37%) Gaps:104/421 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNR 122
            :||:.:..||.     ||..:..|.:|.  ..|||..                 :..|.:.:.|.
Human   118 ILFFFVMGTLL-----RTSFSDPGVLPR--ATPDEAA-----------------DLERQIDIANG 158

  Fly   123 TMNGSVR------------------FCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFY 169
            |.:|..|                  :|..|||.:|.||.|||:|..||.:.|||||||.|||...
Human   159 TSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKR 223

  Fly   170 NYKYFVLF-LGYALVYCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIA 233
            ||::|.:| |..:.:.....||...|..:...:.|..:....|....|.|             :.
Human   224 NYRFFYMFILSLSFLTVFIFAFVITHVILRSQQTGFLNALKDSPASVLEA-------------VV 275

  Fly   234 IMFAI-SLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDK-NGYNLGR-YANFCEVFGDDWQYW 295
            ..|:: |:|.|.|:|.||:..|:||.|..:.......|.:. |.|:.|. :.|.|.....     
Human   276 CFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYNPYSYGNIFTNCCVALCG----- 335

  Fly   296 FLPVFSSRGD--GYSYPTSSDQSRVSTSSPTQRYDAMGDTTTSRLDGNPTDKLIGASPLDTTNHH 358
              |:..|..|  ||..|.:...:  :.|:....|.|    |.|:.|....|:.|           
Human   336 --PISPSLIDRRGYIQPDTPQPA--APSNGITMYGA----TQSQSDMCDQDQCI----------- 381

  Fly   359 HNQSPHQVRSTSVLPTQLLQIQPPSTCRDELNERQQKLANGQSLDCST--------PAAMSSPDE 415
              ||...|...:..|  |||.: ||...|||:...:.   |....|::        ||:|.:..|
Human   382 --QSTKFVLQAAATP--LLQSE-PSLTSDELHLPGKP---GLGTPCASLTLGPPTPPASMPNLAE 438

  Fly   416 RGVNGAAVYIEMIGDHPLTSADPAKGFPRPP 446
            ..:.......:....|...:.|.|   |.||
Human   439 ATLADVMPRKDEHMGHQFLTPDEA---PSPP 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 47/149 (32%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.