DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:160 Identity:49/160 - (30%)
Similarity:67/160 - (41%) Gaps:46/160 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 CEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL-----GYALVYCLYVAF 190
            |..|.:.||.|:.||.:|..||.:.||||.|||||:..:|.:||:::|     ..|.:..:..||
Mouse   151 CPTCDLRKPARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTRYFLIYLLTLTASAATIATVTAAF 215

  Fly   191 -------------TSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHI--LFLFFIAIMFAISL 240
                         |.|.|...|..|...                  |.|  |||.|..|:|.:..
Mouse   216 LLRLVTVSDLYQETYLDDVGHFQAVDTV------------------FLIQHLFLAFPRIVFLLGF 262

  Fly   241 V-----SLFGY---HIYLVLVNRTTLESFR 262
            |     .|.||   .:||...|:||.|.::
Mouse   263 VIVLSMLLAGYLCFALYLAATNQTTNEWYK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 48/155 (31%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 49/158 (31%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.