DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:230 Identity:63/230 - (27%)
Similarity:95/230 - (41%) Gaps:49/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLG 179
            |.:.:..|.:.....:|.:|:...|.|:.|||.|..|:|:.||||..:..||.|:||:.|:..| 
Mouse    80 RGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGCCVGFHNYRPFLCLL- 143

  Fly   180 YALVYCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNA-SGMGRFHILFLFFIAIM-------- 235
                  |:.|...||..|..         |.:....|.| |.:....:|.|.::.::        
Mouse   144 ------LHSAGVLLHISVLL---------GPALSALLQAHSALYTVALLLLPWLMLLTGKVSLAQ 193

  Fly   236 FAISLV--------SLFG----YHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVF 288
            ||::.|        .|.|    :|..|:|..:||.|..|.         .:.|:||...|.....
Mouse   194 FALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARG---------HHCYDLGTCHNLQAAL 249

  Fly   289 GDDWQ-YWFLPVFSS--RGDGYSYPTSSDQSRVST 320
            |..|. .||.|..:|  .|||.|:.|..|...|::
Mouse   250 GPRWALVWFWPFLASPLPGDGISFQTPGDVGLVTS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 42/150 (28%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.