DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_081582.1 Gene:Zdhhc25 / 70073 MGIID:1917323 Length:279 Species:Mus musculus


Alignment Length:324 Identity:83/324 - (25%)
Similarity:128/324 - (39%) Gaps:90/324 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNDDHRR-RKTP-------CGFCMAVFKWIPVLFITAVIAWSY-----YAYVVELCIRNSENRIG 53
            |..:|.. .:||       |.|.:.     |:..:.|:.||:.     :....:|.| .|.|.:.
Mouse     9 GTSEHSAGLETPLQAPNQRCWFILD-----PIGILCAMAAWALVLSGGWVLFRDLLI-PSNNMLY 67

  Fly    54 MIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLP 118
            ::...:.:||..:|.:.|:.||::|..|.:|            |.....|||             
Mouse    68 IVANGVVFHLLASLALASHLRTMLTDPGSVP------------LGNPPGPDT------------- 107

  Fly   119 VTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALV 183
                     |.:|..|....|..|.||:||..|:.|.||||||:|||:...|.|||:||      
Mouse   108 ---------VSYCTDCHSAIPRTACHCTVCQRCIRKNDHHCPWINNCIGEDNQKYFLLF------ 157

  Fly   184 YCLYVAFTSLHDFVEF-------WKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLV 241
             .:|:..||.|..:..       :..|.:|:   |:...|.|.      ||||..:|||..:..|
Mouse   158 -TMYIGLTSTHVLLLLGIPVLCSYMRGEWDS---SSTVSLPAP------ILFLLLVAIMGFLFAV 212

  Fly   242 SLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRY---ANFCEVFGDDWQY-WFLPVFS 301
            .:....:.::..::||.|...          :|.::.||:   ||...|.|..... |..|..|
Mouse   213 VMLCSQMCVIYSDKTTTELLY----------QNTHSGGRWSKCANMKAVCGSHVSLAWLSPFHS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 44/136 (32%)
Zdhhc25NP_081582.1 zf-DHHC 109..230 CDD:279823 44/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.