DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001028745.1 Gene:Zdhhc6 / 66980 MGIID:1914230 Length:413 Species:Mus musculus


Alignment Length:353 Identity:84/353 - (23%)
Similarity:142/353 - (40%) Gaps:110/353 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFY---HL------FLTLFMW------S 71
            |.|::.:.          |:.:|     :.:.||..:|:|   |.      |:.|..|      :
Mouse    22 WGPIIALG----------VIAIC-----STMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILYN 71

  Fly    72 YWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKI 136
            |:..:....|.:|..|: |::....::                             :::|:.|:.
Mouse    72 YFNAMFAGPGFVPRGWK-PEKSQDSMY-----------------------------LQYCKVCQA 106

  Fly   137 IKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAF-------TSLH 194
            .|..|:|||..|:.||:||||||||:|||....|:..|.|||..|.:.|.:.||       |.|:
Mouse   107 YKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGCTHAAFIFVMTMYTQLY 171

  Fly   195 DFVEF-WKVGAYDNNGYSAQGQLNAS----------GMGRF-HILFLFFIAIMFAISLVSLFGYH 247
            :.:.| |.....|         ::|:          |:..| ..||...:|:...|::..||...
Mouse   172 NRLSFGWNTVKID---------MSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQ 227

  Fly   248 IYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVF------GDDWQYWFLPVFS----S 302
            |.::|.|:|::||:         .::...:..:|....|||      |..|:. |..||:    .
Mouse   228 IKIILRNKTSIESW---------IEEKAKDRIQYYQLDEVFIFPYDMGSKWKN-FKQVFTWSGVP 282

  Fly   303 RGDGYSYP--TSSDQSRVSTSSPTQRYD 328
            .|||..:|  ...||..::.....|:.|
Mouse   283 EGDGLEWPIREGCDQYSLTIEQLKQKAD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 48/148 (32%)
Zdhhc6NP_001028745.1 DHHC 95..241 CDD:366691 49/183 (27%)
SH3_2 317..396 CDD:369452
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.