DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006231465.1 Gene:Zdhhc16 / 654495 RGDID:1591893 Length:377 Species:Rattus norvegicus


Alignment Length:331 Identity:95/331 - (28%)
Similarity:142/331 - (42%) Gaps:84/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFKWIPVLFITAVIAWS------YYAYVVELCIRN-SENRIGMIFMLLFY-HLFLTLFMWSYWRT 75
            |.:|..|:|:..||..:      .|..|:.|.:|. |..|:...|   || |..|.|.::.|::.
  Rat    75 VIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHF---FYSHWNLILIVFHYYQA 136

  Fly    76 IMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPD 140
            |.|..| .|.|.|                      |:.|            :|..|:||...||.
  Rat   137 ITTPPG-YPPQGR----------------------NDIA------------TVSICKKCIYPKPA 166

  Fly   141 RAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFW----K 201
            |.||||:|:.|||||||||||:||||..||::||..|..:..:.|:|.::.|...|.|.:    |
  Rat   167 RTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEK 231

  Fly   202 VGAYDNNGYSAQGQLNASGMGRFH-----------------ILFLFFIAIMFAISLVSLFGYHIY 249
            :...|.|      :|.|.....:|                 :::|:|:....|::|.:|..:|..
  Rat   232 MKQLDKN------KLQAIANQTYHQTPPPTFSFRERITHKSLVYLWFLCSSVALALGALTMWHAV 290

  Fly   250 LVLVNRTTLESF-----RAPIFRVGGPDKNGYNLGRYANFCEVFG-DDWQYWFLPVF--SS---R 303
            |:....|::|..     |..:...|...:|.||.|...|:....| |..::|...|.  ||   .
  Rat   291 LISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPH 355

  Fly   304 GDGYSY 309
            |:|.|:
  Rat   356 GNGMSW 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 50/150 (33%)
Zdhhc16XP_006231465.1 DHHC 156..305 CDD:396215 51/154 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.