DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and ZDHHC11B

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_016865599.1 Gene:ZDHHC11B / 653082 HGNCID:32962 Length:445 Species:Homo sapiens


Alignment Length:330 Identity:71/330 - (21%)
Similarity:111/330 - (33%) Gaps:139/330 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GFCMAVFK-WIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIM 77
            |..:|.|: :||:|    ..:|.|.||||          .|.||.   :||.:.|        |.
Human    51 GLSLATFRIFIPLL----PHSWKYIAYVV----------TGGIFS---FHLVVHL--------IA 90

  Fly    78 TSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSV---RFCEKCKI--- 136
            :.:                    |..|:..|::.|:::.:|:.:|:.:..|   :||..||:   
Human    91 SCI--------------------DPADSNVRLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVP 135

  Fly   137 -----------------------------------------IKPDR-----------AHHCSVCS 149
                                                     :.|||           ..||..|:
Human   136 QHPPPASHSLLDALSPGRTGLVPPRHLASSDGPLALPQPAHLGPDRRSPIHPSRNKKTKHCISCN 200

  Fly   150 CCVLKMDHHCPWVNNCVNFYNYKYF--------------VLFLGYALVYCL-----------YVA 189
            .||...||||.|:||||...||.:|              :..|.|.||..|           |..
Human   201 KCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQYLVNPRVLRTDPRYED 265

  Fly   190 FTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVN 254
            ..:::.::.|..:       :..|.|.....:.|..:|.|..:.:   :.|..|..:||||....
Human   266 VKNMNTWLLFLPL-------FPVQVQTLIVVIIRMLVLLLDLLGL---VQLGQLLIFHIYLKAKK 320

  Fly   255 RTTLE 259
            .||.|
Human   321 MTTFE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 44/209 (21%)
ZDHHC11BXP_016865599.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157910
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.