Sequence 1: | NP_001286264.1 | Gene: | CG1407 / 36043 | FlyBaseID: | FBgn0033474 | Length: | 452 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_652670.2 | Gene: | CG18810 / 59171 | FlyBaseID: | FBgn0042133 | Length: | 300 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 52/204 - (25%) |
---|---|---|---|
Similarity: | 82/204 - (40%) | Gaps: | 59/204 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 131 CEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHD 195
Fly 196 FVEFWKVGAYDNNGYSAQGQL--------NASGMGRFHILFLFF-----IAIMFAISLVSLF--- 244
Fly 245 -------------GYHIY-----LVLVNRTTLESFRAPIFR------VGG--P---DKNGYNLG- 279
Fly 280 ---RYANFC 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1407 | NP_001286264.1 | zf-DHHC | 129..259 | CDD:279823 | 42/161 (26%) |
CG18810 | NP_652670.2 | zf-DHHC | 92..>138 | CDD:303066 | 17/38 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45467496 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |