DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and zdhhc14

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:301 Identity:86/301 - (28%)
Similarity:127/301 - (42%) Gaps:43/301 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RRKTPCGFCMAVFKWIPVLFITAVI----AWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLF 68
            |.:..|...:.:.|...|.::|.|:    :..::|:.......|....|..|..:||     ...
Zfish    45 RNRFYCNGRIMMAKQTGVFYLTMVLILVTSGLFFAFDCPFLASNLTPAIPAIGGVLF-----VFV 104

  Fly    69 MWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRI-LNNFA-----RDLPVTNRTM-NG 126
            |....|...:..|.:|   |...||.:        |.:::| .||..     |..|.|...: ||
Zfish   105 MGMLLRASFSDPGVLP---RATPEEAA--------DIERQIDANNGPSGPGYRPPPRTREVLING 158

  Fly   127 ---SVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLF-LGYALVYCLY 187
               .:::|..|||.:|.||.|||:|..||.:.|||||||.|||...||::|.|| |..:.:....
Zfish   159 QTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFILSLSFLTIFI 223

  Fly   188 VAFTSLHDFVE-FWKVGAYDNNGYSAQGQLNASGMGRFHIL-------FLFFIAIMFAI-SLVSL 243
            .||...|..:. ..|..|..........|.:.:|:. |.:|       .|..:...|:: |:|.|
Zfish   224 FAFVITHVILNALRKALALSTAADFEAVQKDPTGLA-FLVLSKTALLDVLEVVVCFFSVWSIVGL 287

  Fly   244 FGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANF 284
            .|:|.||:..|:||.|..:.......|  |..||...|.||
Zfish   288 SGFHTYLISSNQTTNEDIKGSWSSKRG--KGNYNPYSYGNF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 50/139 (36%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 51/143 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.