DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and ZDHHC7

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens


Alignment Length:286 Identity:75/286 - (26%)
Similarity:116/286 - (40%) Gaps:72/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGFCMAVFKWIPVLFITAVIAW-------SYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMW 70
            ||...||..|:.|.:...|:.:       .::..||.          |:||..|     ..|.:.
Human    46 CGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVN----------GVIFNCL-----AVLALS 95

  Fly    71 SYWRTIMT---------------SVGRIPDQWRI---PDEEVSRLFRADSPDTQKRILNNFARDL 117
            |:.||::|               ..|..|....|   ..|.|..|.....|.      .|..::.
Human    96 SHLRTMLTDPEKSSDCRPSACTVKTGLDPTLVGICGEGTESVQSLLLGAVPK------GNATKEY 154

  Fly   118 PVTNRTMNGSVRF-CEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYA 181
            ..:.:...|.|.: |.||..|||:||||||:|..|:.|||||||||||||...|.::||||    
Human   155 MESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLF---- 215

  Fly   182 LVYCLYVAFTSLHDFV----EFWKVGAYDNNGYSAQGQLN-----ASGMGRFHILFLFFIAIMFA 237
               .:|:|.:|:|..:    :|..         ..:||..     :..:....::||....::|.
Human   216 ---TMYIALSSVHALILCGFQFIS---------CVRGQWTECSDFSPPITVILLIFLCLEGLLFF 268

  Fly   238 ISLVSLFGYHIYLVLVNRTTLESFRA 263
            .....:||..|:.:..:.|.:|..::
Human   269 TFTAVMFGTQIHSICNDETEIERLKS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 46/139 (33%)
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 47/143 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.