DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and zdhhc21

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001016073.1 Gene:zdhhc21 / 548827 XenbaseID:XB-GENE-855474 Length:264 Species:Xenopus tropicalis


Alignment Length:280 Identity:82/280 - (29%)
Similarity:116/280 - (41%) Gaps:82/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IGMIFMLLFYH-LF---LTLF------------MWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRA 100
            :|.||.:.||: ||   |.||            :|:|:   :||:..|....|....:..:|  .
 Frog    17 VGAIFFIWFYNTLFIPKLILFPRFDEGQISVAAIWAYY---LTSIFCIISLLRASTADPGKL--Q 76

  Fly   101 DSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNC 165
            |||            .:|:|.:.:   ...|.||.:::|.|:||||.|..||.:|||||||:|||
 Frog    77 DSP------------KIPLTEKEL---WELCNKCNMMRPKRSHHCSRCGHCVRRMDHHCPWINNC 126

  Fly   166 VNFYNYKYFV-------LFLGYALV--YCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGM 221
            |...|:..|:       |..||.||  :|.|..|..|   ...|.:..:.               
 Frog   127 VGEDNHWLFLQLCFYTQLLSGYTLVLDFCHYYYFLPL---AINWDIFIFR--------------- 173

  Fly   222 GRFHILFLF----FIAIMFAISLVSLFGYHIYLVLVNRTTLESFR---APIFRVGGPDKNGYNLG 279
               |.|.|.    |:.|:....:.|||...|..:|.:.||:|...   ..|.|...|.:.     
 Frog   174 ---HELALLRISTFMGIVMFGGMCSLFYTQIMGILTDTTTIEKMANCCDEISRARKPWQQ----- 230

  Fly   280 RYANFCEVFGDDWQ-YWFLP 298
               .|.||||..|: .||:|
 Frog   231 ---TFSEVFGTRWKILWFIP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 47/142 (33%)
zdhhc21NP_001016073.1 DHHC 92..216 CDD:366691 48/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.