DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:275 Identity:74/275 - (26%)
Similarity:114/275 - (41%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RRKTPCGFCM------AVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLT 66
            |.:..||..:      .||....:|.::..|.  ::.:......|.....|.:|..:||:.:...
Mouse    68 RNRFYCGGRLMLAGHGGVFALTLLLILSTTIL--FFVFDCPYLARTLTLAIPIIAAILFFFVMSC 130

  Fly    67 LFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFA---RDLPVTNRTM-NG- 126
            |...|:     |..|.:|           |....::...:|:|.|..:   |..|.|...| || 
Mouse   131 LLQTSF-----TDPGILP-----------RATICEAAALEKQIDNTGSSTYRPPPRTREVMINGQ 179

  Fly   127 --SVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKY---FVLFLGYALVY-- 184
              .:::|..||:.:|.|..|||||..||.:.|||||||.|||...||::   |:|.|.:...:  
Mouse   180 TVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIF 244

  Fly   185 -CLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAI-SLVSLFGYH 247
             |:....|.|                  :||....|.:.:.....|..:...|:| |::.|.|:|
Mouse   245 ACVVTHLTLL------------------SQGSNFLSALKKTPASVLELVICFFSIWSILGLSGFH 291

  Fly   248 IYLVLVNRTTLESFR 262
            .|||..|.||.|..:
Mouse   292 TYLVASNLTTNEDIK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 46/136 (34%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 47/140 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848297
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.