DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and CG5880

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:356 Identity:84/356 - (23%)
Similarity:136/356 - (38%) Gaps:100/356 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSV 80
            |:..|..:.|..:|..:.  ..||.:.|....:::::...|:|:..:..|...::.|...::|..
  Fly    61 CLGPFFVVGVAALTTSVV--SIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPA 123

  Fly    81 GRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHC 145
            |.       |.|.||                            :..:|..|.||...||.|.|||
  Fly   124 GH-------PPEGVS----------------------------LVEAVSMCGKCIAPKPPRTHHC 153

  Fly   146 SVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLH--------DFVEFW-- 200
            |:|:.|:|||||||||:||||.:.|::||.|::.|..:.||::....|.        |..|.|  
  Fly   154 SICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTE 218

  Fly   201 ---------------------KVGAYD--------NNGYSAQGQLNASGMGRFHIL-FLFFIAIM 235
                                 ....||        :|..:.....:|:..||...| |:.|..:.
  Fly   219 IEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVA 283

  Fly   236 FAISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDK-----------NGYNLGRYANFCEVFG 289
            ..::|.||..:|..|:....|::|:      .:...::           |.||.|...|:....|
  Fly   284 VVLALGSLSIWHAKLITRGETSVEA------HINEAERKRHLQQQRIYINPYNFGTKKNWKLFLG 342

  Fly   290 -----DDWQYWFLPVF-SSRGDGYSYPTSSD 314
                 ..|:...||.: ...|.|.|:.|.:|
  Fly   343 LVRGRSFWRTVLLPSWHKPEGTGLSFHTVND 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 51/169 (30%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.