DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and CG17195

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:301 Identity:60/301 - (19%)
Similarity:101/301 - (33%) Gaps:112/301 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQ 86
            ||.|.|||                   .|.:|.:         |..:|.|      :||..:...
  Fly    60 WILVTFIT-------------------HNILGNM---------LACYMTS------SSVNTLSKD 90

  Fly    87 WRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCC 151
            .|.|:.|                      |.|:.:        :||.||.::..|:.||.:|:.|
  Fly    91 SRCPNPE----------------------DEPLWH--------YCESCKKLRSPRSWHCVLCNTC 125

  Fly   152 VLKMDHHCPWVNNCVNFYNYKYFVLFLGYALV--------YCLYVA-----FTSLHDFV------ 197
            :|:.||||.:...|:...|.::|..|..|..:        :|:::.     |.||...:      
  Fly   126 ILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITR 190

  Fly   198 EFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFR 262
            .|::  .|..|.:..             |.||..|:..:..:.  :..|.:.::..|.|....|.
  Fly   191 TFFQ--NYTGNTFET-------------IAFLLNISASYMPAF--MLAYQMQILSQNSTYYNIFD 238

  Fly   263 APIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFL-PVFSS 302
            ..           |:||...|...:.|....:.|: |:..|
  Fly   239 CT-----------YDLGFRKNCQTIMGQRGLWTFISPLLKS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 33/148 (22%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 33/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.