DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and CG17196

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster


Alignment Length:252 Identity:52/252 - (20%)
Similarity:94/252 - (37%) Gaps:100/252 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IGMIFMLLFYHLFLTL------------FMWSY-------------------WRTIMTSVGRIPD 85
            :.:||:|:....|.||            ||:.:                   :|| .::|..:|.
  Fly    26 LSVIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRT-SSAVKSLPQ 89

  Fly    86 QWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSC 150
            :.:||......|:                              .:|:.|:.:.|.|:.||::|.|
  Fly    90 ERQIPKPGTEHLW------------------------------HYCDICQKLMPPRSWHCALCKC 124

  Fly   151 CVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQ 215
            |:||.||||.:...|:...|::|| .:|.:.|.:.::::..:|  ||:                 
  Fly   125 CILKRDHHCIFAATCIGHNNHRYF-FWLTFYLAFGIFMSMATL--FVD----------------- 169

  Fly   216 LNASGMGR-FHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGP 271
                 :|| |::|..........:..:|.|.| :.|:|           .||.:|.|
  Fly   170 -----VGRSFYLLHRMKAGFGNTVKSLSYFRY-VCLIL-----------NIFALGFP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 33/130 (25%)
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 37/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.