DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and CG17197

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:339 Identity:72/339 - (21%)
Similarity:118/339 - (34%) Gaps:107/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VLFITA-----VIAWSYYAYVVELCIRNSENRIG-MIFMLLFYHLF---LTLFMWSYWRTIMTSV 80
            |||:..     |:...:|.......::....::| ::.:.:.|::|   |...:.|      |||
  Fly    28 VLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITS------TSV 86

  Fly    81 GRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHC 145
            ..:|...:||:.|....:                              .:|:.|:.:.|.|:.||
  Fly    87 ESLPKDRQIPEPEEEHQW------------------------------HYCDVCEKLMPPRSWHC 121

  Fly   146 SVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLF-----LGYALVYCLYVAFT----SLHDFV---- 197
            .:|.||:||.|.||.:..:||...|.:||..|     ||..:....::..|    |..|.:    
  Fly   122 ILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNI 186

  Fly   198 ------EFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRT 256
                  .||.|.....|.|                  :|...:...:..:|        ||.|..
  Fly   187 PRDNLPPFWLVITLILNTY------------------VFAAPVSSVLMQLS--------VLKNNG 225

  Fly   257 TLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFL-PVFSS--RGDGYSYPTSSDQSRV 318
            ||..|.:          :.|:||.:.||..:.|....:.|| |...|  ..||..:..    .||
  Fly   226 TLHKFYS----------DTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKI----KRV 276

  Fly   319 STSSPTQRYDAMGD 332
            ...||..::..:.|
  Fly   277 QHHSPKLQFLRVSD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 36/148 (24%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 6/41 (15%)
zf-DHHC 100..>198 CDD:279823 27/127 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.