DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and CG5196

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:301 Identity:85/301 - (28%)
Similarity:124/301 - (41%) Gaps:73/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FYH--LFL---TLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPV 119
            |.|  |||   ||..::|....:|..|.:|.||...|.:          |.|             
  Fly    47 FAHQALFLLLSTLATFNYVMATLTGPGLMPKQWHPKDPK----------DAQ------------- 88

  Fly   120 TNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVY 184
                   .:::|:||:..|..|:|||..|..||.||||||||:|:||.:.|:.||..||      
  Fly    89 -------FLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFL------ 140

  Fly   185 CLYVAFTSLHDFV----EFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFF------IAIMFAIS 239
             |:....||...|    .||: |.| ...|...|..:.:.: :|.:|.:..      :||...|.
  Fly   141 -LFSILGSLQGTVVLCCSFWR-GIY-RYYYLTHGLAHLASV-QFTLLSIIMCILGMGLAIGVVIG 201

  Fly   240 LVSLFGYHIYLVLVNRTTLESF---RAPIFRVGGPDKNG-----YNLGRYANFCEVFGDDWQYWF 296
            |..|....:..::.|:|.:|.:   :|...|....|.:.     |:||..||...||.|:.|   
  Fly   202 LSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLVFNDECQ--- 263

  Fly   297 LPVFSSRGDGYSYPT--SSDQSRVSTSSPTQRYDAMGDTTT 335
                 .||||..:|.  ..||..::.....|:.:....|.|
  Fly   264 -----KRGDGIEWPVVEGCDQYTLTREQLAQKEEKRARTRT 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 46/139 (33%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 47/143 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.