DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Hip14

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001261910.1 Gene:Hip14 / 39747 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster


Alignment Length:371 Identity:81/371 - (21%)
Similarity:122/371 - (32%) Gaps:122/371 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DDHRRRKTPCGFCMAVFKWIPVLFITAVIAWSYY-----AYVVELCIRNSENRIGMIFMLLFYHL 63
            |:|.....|....:|...|.       .:.|..|     ::...:|.        :|..||.:..
  Fly   343 DEHLMALLPLSVYLATKAWF-------YVTWLMYIDDAVSFTATVCF--------LISSLLLWVC 392

  Fly    64 FLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNG-- 126
            ||                   ..|: .|..:.|      |..::|    |...:.::.|...|  
  Fly   393 FL-------------------KSWK-GDPGIIR------PTREQR----FKTIIELSERGGIGFE 427

  Fly   127 SVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFT 191
            ...||..|.:.:|.|:.|||||..||.:.|||||||.||:...|:.||:.||...|:.|.::.:.
  Fly   428 PASFCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGFLWMLLIMCAWMLYG 492

  Fly   192 SLHDFVEFWKVGAYDNNG-YSAQGQLNA-----SGMGRFHILFLFFIAIMFAISLVSLFGYHIYL 250
            ....:|....|...|..| ..|.|..:|     .|....|:.::..:.|.....::.|       
  Fly   493 GSKYYVNQCNVRFDDFLGAMRAIGNCDAWVGWVMGNALLHMSWVILLTICQTYQVICL------- 550

  Fly   251 VLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANF----------------------CEVFG---- 289
               ..||.|..               |.|||.:|                      |..||    
  Fly   551 ---GMTTNERM---------------NRGRYRHFQAKGGHSPFTRGPIQNLVDFLECSCFGLVQP 597

  Fly   290 --DDWQYWFLPVFSSRGDGYSYPTSSDQSRVSTSSPTQRYDAM-GD 332
              .||..::      ..|..::.|...:..:|...|    |.| ||
  Fly   598 KRVDWMNYY------DYDAQTHQTIEKEPLLSVDCP----DGMAGD 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 41/135 (30%)
Hip14NP_001261910.1 ANK 52..165 CDD:238125
Ank_2 52..142 CDD:289560
ANK repeat 77..108 CDD:293786
ANK repeat 110..142 CDD:293786
ANK 114..233 CDD:238125
Ank_2 116..209 CDD:289560
ANK repeat 144..175 CDD:293786
ANK repeat 177..209 CDD:293786
Ank_5 198..251 CDD:290568
ANK repeat 212..244 CDD:293786
zf-DHHC 426..559 CDD:279823 42/157 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.