DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and app

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:496 Identity:120/496 - (24%)
Similarity:172/496 - (34%) Gaps:164/496 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RRKTPC-GFCMA-----VFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLT 66
            |.|..| |..|:     || ::..:.||...| .::|:.......:....|.::..:|:   |.|
  Fly    28 RNKFYCDGLLMSAPHTGVF-YLTCILITGTSA-LFFAFDCPFLADSINPAIPIVGAVLY---FFT 87

  Fly    67 LFMWSYWRTIMTSVGRIP-----------DQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVT 120
              |.|..||..|..|.||           .|..:|:...|..:|  .|...|.:|        |.
  Fly    88 --MSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYR--PPPRTKEVL--------VK 140

  Fly   121 NRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLF---LGYAL 182
            .:|:  .:::|..|||.:|.||.|||:|..||.:.|||||||.|||...||::|.||   |.:..
  Fly   141 GQTV--KLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLA 203

  Fly   183 VYCLYVAFTSL-------HDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISL 240
            |:....:.|.|       |:.....|...:                 ...::|:.|.:|.   |:
  Fly   204 VFIFSCSVTHLVLLMKKEHEVFNVIKAAPF-----------------TVIVVFICFFSIW---SV 248

  Fly   241 VSLFGYHIYLVLVNRTTLESFRAPIFRVGGP-DKNGYNLGRYA-NFCEVFGDDWQYWFLPVFSSR 303
            :.|.|:|.||...::||.|..:......||| .:|.|:.|... |.|.:.               
  Fly   249 IGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHIL--------------- 298

  Fly   304 GDGYSYPTSSDQSRVSTSSPTQRYDAMGDTTTSRLD--GNPTDKLIGASPLDTTNHHHNQSPHQV 366
                                      .|..|.|.:|  |..||:.|       ....|..||...
  Fly   299 --------------------------CGPMTPSLIDRRGIATDEFI-------QQMQHQSSPRHA 330

  Fly   367 RSTSVLPTQLLQIQPP-----------------STCRDELNERQQKLANGQSLDCSTPAAMSSPD 414
            .|..:..:.::....|                 |....||..|        ..|.|.|   ||..
  Fly   331 LSDVLSASHMVTTSQPMMGGLGGGGIGGAGGGISIGGAELKPR--------FYDESNP---SSST 384

  Fly   415 ERGVNGAAVYIEMIG-----DHPLTSADPAKGFPRPPNGDL 450
            ..| ||.|:.....|     |||            ||:.||
  Fly   385 LEG-NGGAINGHGNGHGNGFDHP------------PPSYDL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 45/139 (32%)
appNP_648561.2 zf-DHHC 146..270 CDD:279823 46/143 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467476
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.