DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:281 Identity:76/281 - (27%)
Similarity:113/281 - (40%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIAWSYYAYVVELCIRNSENR----IGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRI---PDQWR 88
            |:.|   ...:.|.:.::|.|    .|.:|:.|.:.|.:...:..|....:...|.:   |....
  Rat    19 VLTW---GITLVLFLHDTELRQWEEQGELFLPLTFLLLVLGSLLLYLAVSLMDPGYVTAQPQPQE 80

  Fly    89 IPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVL 153
            .|.||.:.:.....|                        :|.|..|.:::|.||.||..|..||.
  Rat    81 EPKEEQTAMVPQAIP------------------------LRRCRYCLVLQPLRARHCRECRRCVR 121

  Fly   154 KMDHHCPWVNNCVNFYNYKYFVLFLGYALV---YCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQ 215
            :.||||||:.|||...|:..||.:|...||   :.||:|::.| .|.:.|  |.:          
  Rat   122 RYDHHCPWMENCVGERNHPLFVAYLALQLVVLLWGLYLAWSGL-QFFQPW--GLW---------- 173

  Fly   216 LNASGMGRFHILFLFFIAIMFAISLVS-LFGYHIYLVLVNRTTLE---SFRAPIF--RVGGPDKN 274
            |.::|     :||..|:.:.|...:|| |...|:|||..|.||.|   |.|....  |...|...
  Rat   174 LRSTG-----LLFTTFLLLSFFALVVSLLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDR 233

  Fly   275 G--YNLGRYANFCEVFGDDWQ 293
            |  .||..:  ||......|:
  Rat   234 GPTRNLAHF--FCGWPSGPWE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 49/133 (37%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 39/111 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.