DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and CG4676

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:308 Identity:71/308 - (23%)
Similarity:110/308 - (35%) Gaps:81/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFY--HLFLTLFMWSYWRT 75
            |...:|||..:..:|...::....:|             ||.|:..|.:  .|||...:.|....
  Fly    20 CFLLVAVFVPVTYIFHVTIVMPELFA-------------IGGIWYTLLWLASLFLIFNITSNMLA 71

  Fly    76 IMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPD 140
            .|.....|..:...|..:.::|.|..|                            |:.|:.:.|.
  Fly    72 CMLVDTSIRKELLKPPLDAAQLARWHS----------------------------CQDCQTLVPP 108

  Fly   141 RAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAY 205
            |:.||.||:.||||.||||.:...|:..:||:||..:|.|.::..|..|   :.:.:..|     
  Fly   109 RSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAA---IMESIYLW----- 165

  Fly   206 DNNGYSAQGQLNASGMGRFHILFLFF---IAIMFAISLVSLFGYHIYLVLVNRTTLE-------- 259
                     .|:.....|:..||..|   :::|.:.|..|     .|||:.:.|.|.        
  Fly   166 ---------HLHLDIYWRWSTLFTIFAPVVSLMLSPSWES-----FYLVIYDLTLLGFAISSLLL 216

  Fly   260 SFRAPIFRVGGPDK----NGYNLGRYANFCEVFGDDWQY-WFLPVFSS 302
            .|...||:.|...:    ..|:.|...|...|.|..... |..|...|
  Fly   217 VFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 38/132 (29%)
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/154 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.